DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and Drc3

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_017452569.1 Gene:Drc3 RGDID:1309150 Length:594 Species:Rattus norvegicus

Alignment Length:159 Identity:52/160 (33%)
Similarity:80/160 (50%) Gaps:5/160 (3%)


  Fly    18 EQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYI 82
            :|:..|...|:.||..:..|.::|: |.......::.::.|:||:|.||..:..|..|.||.|.|
  Rat   107 KQEGILFKDVLALQLDFQNILRIDN-LWQFENLRKLQLNNNIIERIEGLENLTHLVWLDLSFNNI 170

  Fly    83 KQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVV 147
            :.|.||:.:. .||:|.||:|.|.||..|..|..|:||.:.||.|.:......|.....|..|.:
  Rat   171 EAIEGLDTLV-NLEDLSLSHNRISKIDSLDPLVNLQVLSLGNNQINNMMNIIYLRRFPCLRTLSL 234

  Fly   148 VGNPLSEGLDEPTWRAECIKRLPTIRKLD 176
            .|||:||..:   ::......||.:..||
  Rat   235 SGNPVSEAEE---YKVFIYAYLPDLVYLD 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 52/160 (33%)
leucine-rich repeat 50..71 CDD:275380 6/21 (29%)
leucine-rich repeat 95..116 CDD:275380 11/21 (52%)
leucine-rich repeat 117..141 CDD:275380 7/24 (29%)
Drc3XP_017452569.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.