DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and Lrrc23

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_006505721.1 Gene:Lrrc23 MGIID:1315192 Length:370 Species:Mus musculus

Alignment Length:138 Identity:44/139 (32%)
Similarity:75/139 (54%) Gaps:12/139 (9%)


  Fly    42 STLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIE 106
            |:|.||      .:..|.:|...|:...| ||.|.|::|.:|::.|||.:: .|..|.|..|.||
Mouse   206 SSLHTL------ELRGNQLESTKGIYLPK-LKNLYLAQNLLKKVEGLENLS-NLTTLHLRDNQIE 262

  Fly   107 KIKGLT-GLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLP 170
            .:.|.: .:|.|:.|.:.:|:|.|.:|..:|.::..|..||::.||.:   ||..:|.|.:.::.
Mouse   263 TLNGFSQEMKSLQYLNLRSNMISDLAELAKLRDLPKLRALVLLDNPCA---DETDYRQEALVQMA 324

  Fly   171 TIRKLDGE 178
            .:.:||.|
Mouse   325 HLERLDKE 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 44/139 (32%)
leucine-rich repeat 50..71 CDD:275380 4/21 (19%)
leucine-rich repeat 95..116 CDD:275380 8/22 (36%)
leucine-rich repeat 117..141 CDD:275380 7/24 (29%)
Lrrc23XP_006505721.1 leucine-rich repeat 100..119 CDD:275380
LRR_4 119..154 CDD:289563
leucine-rich repeat 120..141 CDD:275380
leucine-rich repeat 142..162 CDD:275380
leucine-rich repeat 163..183 CDD:275380
leucine-rich repeat 184..207 CDD:275380 1/1 (100%)
leucine-rich repeat 208..228 CDD:275380 6/26 (23%)
LRR_8 227..284 CDD:290566 21/59 (36%)
LRR_4 227..269 CDD:289563 17/44 (39%)
leucine-rich repeat 229..250 CDD:275380 9/22 (41%)
LRR_4 250..292 CDD:289563 14/42 (33%)
leucine-rich repeat 251..273 CDD:275380 8/22 (36%)
leucine-rich repeat 274..298 CDD:275380 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15454
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.