DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and LRGUK

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001352629.1 Gene:LRGUK HGNCID:21964 Length:1131 Species:Homo sapiens

Alignment Length:187 Identity:49/188 (26%)
Similarity:88/188 (47%) Gaps:31/188 (16%)


  Fly    21 NSLTAKVIDLQFQWPPIEKMDSTLGTLVQCE---RISMSTNMIEKIFGLSGMKCLKVLSLSRNYI 82
            ::||..::|    ...||::..    |..|.   .:|::.|.|..|.||:.:. :|:|.||.|.|
Human   215 HALTKLILD----GNEIEEISG----LEMCNNLIHLSLANNKITTINGLNKLP-IKILCLSNNQI 270

  Fly    83 KQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVV 147
            :.|:|||.: :.|:.|.||:|.|..::||.....|:|:.:.:|.|.:..|...:..:..|..|.:
Human   271 EMITGLEDL-KALQNLDLSHNQISSLQGLENHDLLEVINLEDNKIAELREIEYIKNLPILRVLNL 334

  Fly   148 VGNPLSE----------------GLDEPTWRAECIKRLPTIRKLDGEPVVLNEEPQL 188
            :.||:.|                .||:...:.|  :::..:.|.|..|.|:..:..|
Human   335 LENPIQEKSEYWFFVIFMLLRLTELDQKKIKVE--EKVSAVNKYDPPPEVVAAQDHL 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 48/182 (26%)
leucine-rich repeat 50..71 CDD:275380 7/24 (29%)
leucine-rich repeat 95..116 CDD:275380 8/21 (38%)
leucine-rich repeat 117..141 CDD:275380 5/24 (21%)
LRGUKNP_001352629.1 LRR 1 129..149
leucine-rich repeat 131..150 CDD:275380
LRR <150..>337 CDD:227223 38/132 (29%)
LRR 2 150..171
leucine-rich repeat 151..172 CDD:275380
LRR 3 172..193
leucine-rich repeat 173..194 CDD:275380
LRR 4 194..215 49/188 (26%)
leucine-rich repeat 195..216 CDD:275380 0/1 (0%)
LRR 5 216..237 7/29 (24%)
leucine-rich repeat 217..238 CDD:275380 7/29 (24%)
LRR 6 238..259 6/21 (29%)
leucine-rich repeat 258..281 CDD:275380 10/25 (40%)
LRR 7 260..280 10/21 (48%)
LRR 8 281..302 8/21 (38%)
leucine-rich repeat 282..300 CDD:275380 8/18 (44%)
LRR 9 303..324 5/21 (24%)
leucine-rich repeat 304..328 CDD:275380 5/24 (21%)
GMPK 416..592 CDD:238026
Atrophin-1 <784..1126 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.