DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and Dnal1

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_083097.2 Gene:Dnal1 MGIID:1921462 Length:190 Species:Mus musculus

Alignment Length:188 Identity:112/189 (59%)
Similarity:141/189 (75%) Gaps:1/189 (1%)


  Fly     1 MSKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFG 65
            |:|||||||||.||||:..|....||.|.|..|.|||||||::|.||..||::|:|||.||||..
Mouse     1 MAKATTIKEALSRWEEKTGQKPSDAKEIKLYAQIPPIEKMDASLSTLGNCEKLSLSTNCIEKIAN 65

  Fly    66 LSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDW 130
            |:|:|.|::|||.||.||.::|||||.|||||||:|||.|||:||:..:|.||:||:||||:|||
Mouse    66 LNGLKNLRILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDW 130

  Fly   131 SEFNRLAEIESLEDLVVVGNPLSEGLD-EPTWRAECIKRLPTIRKLDGEPVVLNEEPQ 187
            :||.:|||:..|||||.|||||.|... |..|..|..||:|.::||||.||:..:|.:
Mouse   131 AEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTPVIKEDEEE 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 100/171 (58%)
leucine-rich repeat 50..71 CDD:275380 13/21 (62%)
leucine-rich repeat 95..116 CDD:275380 14/21 (67%)
leucine-rich repeat 117..141 CDD:275380 16/24 (67%)
Dnal1NP_083097.2 LRR_4 49..89 CDD:289563 23/40 (58%)
LRR 1 49..70 12/21 (57%)
leucine-rich repeat 50..71 CDD:275378 13/21 (62%)
LRR_8 70..127 CDD:290566 38/57 (67%)
LRR 2 71..92 13/21 (62%)
leucine-rich repeat 72..90 CDD:275378 11/18 (61%)
LRR 3 94..115 14/21 (67%)
LRR_4 95..133 CDD:289563 26/38 (68%)
leucine-rich repeat 95..116 CDD:275382 14/21 (67%)
LRR 4 116..137 14/21 (67%)
leucine-rich repeat 117..140 CDD:275382 16/23 (70%)
leucine-rich repeat 142..172 CDD:275382 17/30 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158733375
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 1 1.000
Homologene 1 1.000 H34623
Inparanoid 1 1.050 221 1.000 Inparanoid score I3517
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007569
OrthoInspector 1 1.000 T615253
orthoMCL 1 0.900 OOG5_129790
Panther 1 1.100 LDO PTHR15454
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4855
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.