DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and lrrc49

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001123802.1 Gene:lrrc49 XenbaseID:XB-GENE-1011788 Length:763 Species:Xenopus tropicalis

Alignment Length:148 Identity:45/149 (30%)
Similarity:83/149 (56%) Gaps:5/149 (3%)


  Fly    37 IEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLS 101
            |:|: |.|..|...:.:.:..|.|.||..:|.::.|:||:|:||.|.|:..:..: ::|:||.|.
 Frog   244 IQKI-SNLENLKNLDVLDLHGNQIAKIENVSHLRELRVLNLARNQINQVENINGL-DSLKELNLR 306

  Fly   102 YNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECI 166
            .|.|..::.:..|..|::||:|.|.|...::...||:..||.|:.:.|||:::   |..:|...:
 Frog   307 DNKITFLRDVDTLPSLQLLYLSFNNISRINDILCLADSTSLSDVTLDGNPIAQ---ESWYRQTIL 368

  Fly   167 KRLPTIRKLDGEPVVLNE 184
            ..:..:|:||.:.:...|
 Frog   369 GHMLQLRQLDMKRITEEE 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 44/147 (30%)
leucine-rich repeat 50..71 CDD:275380 5/21 (24%)
leucine-rich repeat 95..116 CDD:275380 7/21 (33%)
leucine-rich repeat 117..141 CDD:275380 8/24 (33%)
lrrc49NP_001123802.1 LRR_4 188..230 CDD:289563
LRR_8 189..244 CDD:290566 45/149 (30%)
leucine-rich repeat 190..211 CDD:275380
LRR_4 210..252 CDD:289563 4/9 (44%)
leucine-rich repeat 212..233 CDD:275380
LRR_8 232..288 CDD:290566 16/45 (36%)
LRR_4 233..274 CDD:289563 10/31 (32%)
leucine-rich repeat 234..255 CDD:275380 5/12 (42%)
LRR_4 254..296 CDD:289563 13/42 (31%)
leucine-rich repeat 256..277 CDD:275380 5/21 (24%)
LRR_8 276..332 CDD:290566 20/57 (35%)
leucine-rich repeat 278..299 CDD:275380 8/22 (36%)
LRR_4 299..338 CDD:289563 13/39 (33%)
leucine-rich repeat 300..321 CDD:275380 7/21 (33%)
leucine-rich repeat 322..346 CDD:275380 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.