DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and si:ch211-103e16.5

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_009296335.1 Gene:si:ch211-103e16.5 ZFINID:ZDB-GENE-110913-104 Length:607 Species:Danio rerio

Alignment Length:111 Identity:36/112 (32%)
Similarity:55/112 (49%) Gaps:10/112 (9%)


  Fly    72 LKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRL 136
            |..|.::.:.|..:..|......|:.|||:...:..::||..|..||.||::.|.|.|.|..:.|
Zfish    86 LTQLKMNNSLISSVRDLGTSLSHLQILWLARCSLTDLEGLPALSSLKELYVAYNSISDLSPVSML 150

  Fly   137 AEIESLEDLVVVGNPLSEGLDE--PTWRAECIKRLPTIRKLDGEPV 180
               |:||.|.:.||    .:||  ..|...|.::|.|: .|:|.||
Zfish   151 ---ENLELLDLEGN----NVDELAQLWYLGCCEKLRTL-SLEGNPV 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 36/112 (32%)
leucine-rich repeat 50..71 CDD:275380
leucine-rich repeat 95..116 CDD:275380 7/21 (33%)
leucine-rich repeat 117..141 CDD:275380 10/24 (42%)
si:ch211-103e16.5XP_009296335.1 leucine-rich repeat 86..108 CDD:275380 4/22 (18%)
LRR_9 88..229 CDD:258718 35/110 (32%)
LRR_4 108..148 CDD:289563 15/40 (38%)
leucine-rich repeat 109..130 CDD:275380 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.