DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hig and CG9095

DIOPT Version :10

Sequence 1:NP_724773.1 Gene:hig / 35949 FlyBaseID:FBgn0010114 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_001096984.1 Gene:CG9095 / 32447 FlyBaseID:FBgn0030617 Length:1141 Species:Drosophila melanogaster


Alignment Length:119 Identity:20/119 - (16%)
Similarity:47/119 - (39%) Gaps:41/119 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PHAVDVLYAKIESPV---LQTAA------------DQIYDYFIAKGLMQKK---YEHVKLHATLI 132
            |....::|.|:.:.|   |..:|            |:.:.|.:..|..:|.   :|::|....:.
  Fly    27 PGGGGMMYGKVNATVTISLPVSANYRRLVVSLKGVDEEHIYRVCNGKNKKTCGYWENIKNKKKVP 91

  Fly   133 NSL--FRASQSEIVDEKAAERKRITFDASEILRL--YGEYDFGS-----LVLNE 177
            :.:  :..::..::.:|              :||  :|:|..|:     .|:|:
  Fly    92 SGVTTYNKNKKALIIKK--------------MRLEDFGDYMTGNKKTKLFVMNQ 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
higNP_724773.1 Ig_3 612..696 CDD:464046
PHA02927 705..952 CDD:222943
CG9095NP_001096984.1 CCP 37..93 CDD:153056 9/55 (16%)
FTP 94..242 CDD:128870 8/52 (15%)
CLECT 256..375 CDD:214480
PHA02927 <368..557 CDD:222943
PHA03247 <527..725 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.