DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and gsx1

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001039254.1 Gene:gsx1 XenbaseID:XB-GENE-855502 Length:243 Species:Xenopus tropicalis

Alignment Length:373 Identity:98/374 (26%)
Similarity:116/374 (31%) Gaps:182/374 (49%)


  Fly    28 PKPFSIESLIANQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLTQFP-LYNPW--L 89
            |:.|.::|||..:|.......|||                             .|| ..:|.  |
 Frog     2 PRSFLVDSLILRETNEKKVESSPP-----------------------------LFPYAVHPTHPL 37

  Fly    90 HGYFAQN-HERLTHLIAGGCYLPSS-PAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHP 152
            ||..|.: |.|.:.|:   |..|.. .|.|                .|||        ||.:| .
 Frog    38 HGLPAGSCHSRKSGLL---CVCPMCVTASH----------------LHPP--------PPGIP-L 74

  Fly   153 LDTRFLPFN----PAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGM 213
            |...|..|.    ||..|        |:          ||.|....:.|            .|.:
 Frog    75 LKASFSSFGTQYCPAGLG--------RQ----------HSASTGINVSH------------GPAL 109

  Fly   214 AQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNG 278
            .|...|.|                :|       ..|.|       ||:..||             
 Frog   110 YQAAYPLP----------------DP-------RQFHC-------ISVDSSP------------- 131

  Fly   279 AYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKY 343
                                               |..|.|:|.||||||.|||||||||.:..|
 Frog   132 -----------------------------------SQLSSSKRMRTAFTSTQLLELEREFASNMY 161

  Fly   344 LSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTS------HG 385
            ||...|.:|||.|.|||.||||||||||.|.|  |.|.:|      ||
 Frog   162 LSRLRRIEIATYLNLSEKQVKIWFQNRRVKHK--KEGKSSTHRASPHG 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 36/51 (71%)
gsx1NP_001039254.1 homeobox 137..196 41/61 (67%)
Homeobox 141..193 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.