DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and ceh-63

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001123094.1 Gene:ceh-63 WormBaseID:WBGene00045215 Length:152 Species:Caenorhabditis elegans

Alignment Length:111 Identity:40/112 (36%)
Similarity:59/112 (53%) Gaps:14/112 (13%)


  Fly   318 KSRR--RRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAG 380
            :|.|  :||.|||||:..||.||...:|:....|.::|.:::|:|.|||.||||||.|.:|..:.
 Worm    38 RSNRPTKRTTFTSEQVTLLELEFAKNEYICKDRRGELAQTIELTECQVKTWFQNRRTKKRRCTSP 102

  Fly   381 LTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQH-QQLEKMCLSGP 425
            |....:.::...|      |.|.:.:     ||| |.|:....|.|
 Worm   103 LRKSMMKKSDERS------PSPQNPS-----SQHVQNLQTFFHSWP 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/51 (49%)
ceh-63NP_001123094.1 Homeobox 44..97 CDD:278475 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.860

Return to query results.
Submit another query.