DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxa5a

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571615.1 Gene:hoxa5a ZFINID:ZDB-GENE-000823-9 Length:227 Species:Danio rerio

Alignment Length:208 Identity:60/209 (29%)
Similarity:84/209 (40%) Gaps:40/209 (19%)


  Fly   192 HARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSC 256
            |:...|..::|...:...:...|.......|...||...|..|.|              ||..:.
Zfish    19 HSSPGHFLSSGERTQSYKDSPTATPVRYNQPVTASSAEPSSDHLP--------------CSSLAN 69

  Fly   257 SDIS------LTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQ------ 309
            |.:|      |.:|..:..|...||..   |....|..|....:....:..|.|...||      
Zfish    70 SPVSEQSHRALKISLSSTAGSASKSFG---TVLSREGVSKVSSSMEEEKPPGSGQTASQNVSEAP 131

  Fly   310 -----------GNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQV 363
                       .:.:.:..:.:|.|||:|..|.||||:|||..:||:...|.:||.:|.|||.|:
Zfish   132 QIYPWMRKLHISHDNLAGPEGKRPRTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHTLCLSERQI 196

  Fly   364 KIWFQNRRAKWKR 376
            ||||||||.|||:
Zfish   197 KIWFQNRRMKWKK 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)
hoxa5aNP_571615.1 Homeobox 155..208 CDD:278475 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.