DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxb6b

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571613.1 Gene:hoxb6b ZFINID:ZDB-GENE-000823-7 Length:224 Species:Danio rerio

Alignment Length:189 Identity:54/190 (28%)
Similarity:84/190 (44%) Gaps:25/190 (13%)


  Fly   205 HEDQANPGMAQLQEPTPPQAHSSPA-----KSGSHSPMEPALDVGMDEDFECSGDSCS----DIS 260
            |...|..|...:|:.....::...|     :|||.|    |.|......:..:..||:    :.|
Zfish    38 HYPSATFGATNVQDKVYTSSYYQQAGGVFGRSGSTS----ACDYSTPNIYRSADRSCAIGSLEDS 98

  Fly   261 LTMSPRNYNGEMDKSRNGAYTNSDSEDCSD-DEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRT 324
            |.::......:..:.....|.:::.:.|:. ....|..:...||.|           |..||.|.
Zfish    99 LVLTQDQCKTDCTEQGTERYFSTEDKPCTPVYPWMQRMNSCNGMPG-----------STGRRGRQ 152

  Fly   325 AFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTS 383
            .:|..|.||||:|||..:||:...|.:|:.:|.|:|.|:||||||||.|||:....:.|
Zfish   153 TYTRFQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKKENKAVNS 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/51 (53%)
hoxb6bNP_571613.1 Antp-type hexapeptide 129..134 0/5 (0%)
Homeobox 151..203 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.