DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxa1a

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571611.1 Gene:hoxa1a ZFINID:ZDB-GENE-000823-5 Length:329 Species:Danio rerio

Alignment Length:307 Identity:82/308 (27%)
Similarity:105/308 (34%) Gaps:111/308 (36%)


  Fly   120 AQQPQAQAQPQPPPPHPPTHALEKQLPPTL-----PHPLDTRFLPFNPAAAGVAPTDLSYRRLAE 179
            :.|....:|||        .|...|.|.||     .||           :.|.......|...| 
Zfish    58 SSQDVINSQPQ--------QAGSYQSPGTLSITYSAHP-----------SYGTQSFCTGYNHYA- 102

  Fly   180 LMNQDYVHSLSV------------------HARLQHMAAAGRMH---------------EDQAN- 210
             :|||...|:|.                  |...:|..::|.:|               .|||| 
Zfish   103 -LNQDVESSVSFPQCGPLVYSGNISSTVVQHRHHRHGYSSGNVHLHGQFQYGSATYGNSSDQANL 166

  Fly   211 PGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKS 275
            ..:|....|..| .| .|......||:...:..|...|:                      |...
Zfish   167 TFVAGCSNPLSP-LH-VPHHDACCSPLSDGVPTGQTFDW----------------------MKVK 207

  Fly   276 RNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHA 340
            ||...|....|              .|.||:.:            ..||.|:::||.|||:|||.
Zfish   208 RNPPKTGKAGE--------------YGFGGQPN------------TVRTNFSTKQLTELEKEFHF 246

  Fly   341 KKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW-KRVKAGLTSHGL 386
            .|||:...|.:||.||:|:|.||||||||||.|. ||.|.||....|
Zfish   247 NKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPKSL 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/52 (60%)
hoxa1aNP_571611.1 Antp-type hexapeptide 200..205 2/27 (7%)
Homeobox 229..281 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.