DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxc1a

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571606.1 Gene:hoxc1a ZFINID:ZDB-GENE-000822-2 Length:302 Species:Danio rerio

Alignment Length:288 Identity:80/289 (28%)
Similarity:112/289 (39%) Gaps:75/289 (26%)


  Fly   164 AAGVAPTDLSYRRLAELMNQDYVHS----LSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQA 224
            |.||......:...|:..:::.|::    |..|.......|.|...:...:||.|....|..||.
Zfish    20 ATGVMRLHQDHGSTADFPSREDVNNEADFLQYHFTNLCATATGACSKPCEDPGRANSTRPPFPQN 84

  Fly   225 HSSPAKSGSHSPMEPALDVGMDEDFECSGDS-CSDISLTMSP---------------RNYNG--- 270
            .........:.|..|:.....::.....|.| .||...|.|.               |.|:|   
Zfish    85 QDFYRPVHPNRPQVPSFQSCREQGLSRKGFSPSSDTFRTFSSAHCELGPVNNTQTEVRTYDGPVR 149

  Fly   271 ----EMDKSRNGAYTNSDSE--------------------------DCSDDEGAQSRHEGGGMGG 305
                |.|.:.:|| .|:.:|                          .|||.| .::.|      |
Zfish   150 HSAVEDDNTGHGA-LNTLNETLHSGKTFEWMRVRRNQSRAAKIQLGKCSDRE-LKTNH------G 206

  Fly   306 KDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNR 370
            :||..:.||..|     ||.||::||.|||:|||..|||:...|.:||..|:|||.|||||||||
Zfish   207 RDSDEDTSSGGS-----RTNFTTKQLTELEKEFHFNKYLTRARRIEIANPLQLSETQVKIWFQNR 266

  Fly   371 RAKWKRVKAGLTSHGLGRNGTTSGTKIV 398
            |.|.|::.         |.|...|..::
Zfish   267 RMKQKKML---------REGLAQGLMLI 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/51 (63%)
hoxc1aNP_571606.1 Homeobox 218..271 CDD:278475 34/58 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.