DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and meox2b

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001038589.1 Gene:meox2b ZFINID:ZDB-GENE-060503-853 Length:289 Species:Danio rerio

Alignment Length:311 Identity:85/312 (27%)
Similarity:110/312 (35%) Gaps:99/312 (32%)


  Fly    84 LYNPW-----LHGYFAQN-HERLTHLIAGGCYLPSSPAGHPAAQQ----PQAQAQPQPPPPHPPT 138
            |.||.     ||..|.|. |.|..|:.......||.|..:...:.    ...:..|.|..||.|.
Zfish     9 LRNPHAPSQALHPAFTQALHGRSDHISYPDLPGPSPPCSYAGEESSFGGAHHRVHPAPQHPHHPQ 73

  Fly   139 HALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGR 203
            |  .:...|.:|.....|                              |.|.:            
Zfish    74 H--HQWHVPQMPSIESER------------------------------HGLCL------------ 94

  Fly   204 MHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNY 268
            .|.|.|.|.:......:......:|..:||    :|            ||.||       .|..|
Zfish    95 PHPDAAAPELCGTGAGSQGMCAGNPTLTGS----DP------------SGVSC-------VPGEY 136

  Fly   269 NGE----MDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSE 329
            ..:    ::..|..:...|||.|..|  |:..                |..:||.|:.|||||.|
Zfish   137 GRQNMSPVEPERRSSKGKSDSSDSQD--GSYK----------------SDVSSKPRKERTAFTKE 183

  Fly   330 QLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAG 380
            |:.|||.||....||:...|.:||.:|.|:|.|||:||||||.||||||.|
Zfish   184 QIRELESEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGG 234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/51 (59%)
meox2bNP_001038589.1 Homeobox 177..229 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.