DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxd1

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001016678.1 Gene:hoxd1 XenbaseID:XB-GENE-482731 Length:301 Species:Xenopus tropicalis

Alignment Length:331 Identity:89/332 (27%)
Similarity:120/332 (36%) Gaps:104/332 (31%)


  Fly   106 GGCYLPSSPAGHPAAQQPQAQAQP-------QPPPP------HPPT--------HALEKQLPPTL 149
            ||  :|.|.| |.|:.|..|...|       :||||      |..|        |.:|:    |.
 Frog    46 GG--VPGSVA-HQASHQSPALYAPCSLDVAYEPPPPSDYSFLHSSTDYDYYGSNHLVEE----TG 103

  Fly   150 PH-PLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHED-QANPG 212
            .| |..:...|.|  .:.:....||||.|.|               ...||...:..|. :..||
 Frog   104 GHIPYGSSVFPGN--GSYILNGQLSYRTLGE---------------ETQMAQIAQCKEPLEVYPG 151

  Fly   213 MAQLQEPTP-PQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSR 276
             ..||..:| |..:..||        .||.|..:           |........||...:..:|.
 Frog   152 -GNLQSISPSPGTYPKPA--------SPASDTHV-----------STFDWMKVKRNPPKKSLQSE 196

  Fly   277 NGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAK 341
            .|.    .|..|:                                .||.||::||.|||:|||..
 Frog   197 YGV----ASPPCT--------------------------------VRTNFTTKQLTELEKEFHFN 225

  Fly   342 KYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVN 406
            |||:...|.:||.||:|::.||||||||||.|.|:.:...:......:|..|...:..|:...|:
 Frog   226 KYLTRARRIEIANSLQLNDTQVKIWFQNRRMKQKKREREGSLPNSPPSGPASSICVKTPLSKSVH 290

  Fly   407 RFAVRS 412
            ..|..|
 Frog   291 ETATLS 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)
hoxd1NP_001016678.1 Antp-type hexapeptide. {ECO:0000255} 178..183 0/5 (0%)
Homeobox 207..259 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.