DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and Hoxb4

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001094257.1 Gene:Hoxb4 RGDID:1560113 Length:250 Species:Rattus norvegicus

Alignment Length:320 Identity:87/321 (27%)
Similarity:115/321 (36%) Gaps:123/321 (38%)


  Fly    85 YNPWLH--GYFAQNHERLTHLIAGGCYLPSSPAGHPA---AQQPQAQAQPQPPPPHPPTHALEKQ 144
            |.|..|  ||:|....|.:.      :.|.:..|..|   .|:..|...|.||||.||       
  Rat    28 YLPSDHSPGYYAGGQRRESG------FQPEAAFGRRAPCTVQRYAACRDPGPPPPPPP------- 79

  Fly   145 LPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQA 209
             ||..|.|                                   .||..|.:|..|.| .:.|...
  Rat    80 -PPPPPPP-----------------------------------GLSPRAPVQSTAGA-LLPEPGQ 107

  Fly   210 NPGMAQLQEPTPPQAHSSPAKSGSHSP-MEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMD 273
            ...:.....|.||.|.:....|.|||. .||.:...|.:         ..:| |::| ||.|   
  Rat   108 RSEVVSSSPPPPPCAQNPLHPSPSHSACKEPVVYPWMRK---------VHVS-TVNP-NYAG--- 158

  Fly   274 KSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREF 338
                                                       .:.:|.|||:|.:|:||||:||
  Rat   159 -------------------------------------------GEPKRSRTAYTRQQVLELEKEF 180

  Fly   339 HAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLG----RNGTTSG 394
            |..:||:...|.:||.:|.|||.|:||||||||.|||:      .|.|.    |:|.|:|
  Rat   181 HYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKK------DHKLPNTKIRSGGTAG 234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)
Hoxb4NP_001094257.1 Homeobox 164..217 CDD:278475 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.