DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and gsx1

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001012251.1 Gene:gsx1 ZFINID:ZDB-GENE-041008-135 Length:243 Species:Danio rerio

Alignment Length:371 Identity:92/372 (25%)
Similarity:107/372 (29%) Gaps:180/372 (48%)


  Fly    28 PKPFSIESLIANQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLTQFPLYNPWLHGY 92
            |:.|.::|||..:.....|..|||                             .||        |
Zfish     2 PRSFLVDSLILRENSEKGTENSPP-----------------------------LFP--------Y 29

  Fly    93 FAQNHERLTHLIAGGCYLPSSPAG----HPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPL 153
            .......|..|.||.|:  |..||    .|.....|.         ||.        ||.|| .:
Zfish    30 AVHPSHPLHSLSAGSCH--SRKAGLLCFCPLCVTSQL---------HPS--------PPALP-LI 74

  Fly   154 DTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHED------QANPG 212
            ...|..|                     ...|.||           |..|.|..      .:..|
Zfish    75 KASFPAF---------------------GTQYCHS-----------ALSRQHSTSSGVNLNSGSG 107

  Fly   213 MAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRN 277
            :.|...|.|                                          .||.::        
Zfish   108 LYQAAYPVP------------------------------------------DPRQFH-------- 122

  Fly   278 GAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKK 342
                      |...|                  |.||....|:|.||||||.|||||||||.:..
Zfish   123 ----------CISIE------------------NSSSQLQSSKRMRTAFTSTQLLELEREFTSNM 159

  Fly   343 YLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV-KAGLTSHGLG 387
            |||...|.:|||.|.|||.||||||||||.|.|:. |:|  ||..|
Zfish   160 YLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKSG--SHRTG 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 36/51 (71%)
gsx1NP_001012251.1 Homeobox 140..192 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.