DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxc8

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001006787.1 Gene:hoxc8 XenbaseID:XB-GENE-480999 Length:242 Species:Xenopus tropicalis

Alignment Length:167 Identity:46/168 (27%)
Similarity:66/168 (39%) Gaps:37/168 (22%)


  Fly   225 HSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRN--YNGEMDKSRNGAYTNSDSED 287
            |.|.:.|.|.....|..       ..|.||:.........||.  |..:.:.|      .....|
 Frog    62 HGSSSLSNSGFQQNPCA-------LTCHGDASKFYGYEALPRQSLYGAQQEAS------VVQYPD 113

  Fly   288 CSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKS-------------RRRRTAFTSEQLLELEREFH 339
            |.......:         .:.||:.:.::|.|             |..|..::..|.||||:||.
 Frog   114 CKSSSNTNT---------SEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFL 169

  Fly   340 AKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            ...||:...|.:::.:|.|:|.||||||||||.|||:
 Frog   170 FNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKK 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/51 (49%)
hoxc8NP_001006787.1 Homeobox 153..205 CDD:306543 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.