DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and Antp

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:393 Identity:95/394 (24%)
Similarity:137/394 (35%) Gaps:113/394 (29%)


  Fly    38 ANQTPATATPPSPPEER-----DQEQEAEQEQELSARAMVASSALG--LTQFPLYNPWLHGYFAQ 95
            ||.......|..||.:|     .|..:.:|:.::.:|....||.:|  :.|            ||
  Fly    49 ANHQGNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQ------------AQ 101

  Fly    96 NHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPT---LPHPLDTRF 157
            .:.:|     |...........|:..|.|.|||..|       ..|::|||..   :.||...:.
  Fly   102 TNGQL-----GVPQQQQQQQQQPSQNQQQQQAQQAP-------QQLQQQLPQVTQQVTHPQQQQQ 154

  Fly   158 LPFNPAAA---------GVAPTDLSYRRLAELMNQDYVHSLSVHARLQH-----MAAAG------ 202
            .|...|:.         |:.|...|    ..|::|...|.::....|.|     .|..|      
  Fly   155 QPVVYASCKLQAAVGGLGMVPEGGS----PPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGV 215

  Fly   203 ----RMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTM 263
                .:|::..|.||.|.|...||.  .:|.:...|....|.                       
  Fly   216 PDVTEVHQNHHNMGMYQQQSGVPPV--GAPPQGMMHQGQGPP----------------------- 255

  Fly   264 SPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQS------RHEGGGMGGKDSQGNGSSSNSKSRRR 322
                   :|.:...|.:|.......|...|..|      |.:.|             ...:.:|.
  Fly   256 -------QMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFG-------------KCQERKRG 300

  Fly   323 RTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLG 387
            |..:|..|.||||:|||..:||:...|.:||.:|.|:|.|:||||||||.|||:........|.|
  Fly   301 RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSG 365

  Fly   388 RNG 390
            ..|
  Fly   366 GEG 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/51 (55%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.