DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and pb

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_476669.3 Gene:pb FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster

Alignment Length:197 Identity:62/198 (31%)
Similarity:83/198 (42%) Gaps:40/198 (20%)


  Fly   306 KDSQGNGSSSNSKS---------RRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEV 361
            |.|..|....||.:         ||.|||:|:.||||||:|||..|||....|.:||.||.|:|.
  Fly   176 KSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTER 240

  Fly   362 QVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLE------KM 420
            |||:||||||.|.||.....|..                   ..|:.:::....|.:      |.
  Fly   241 QVKVWFQNRRMKHKRQTLSKTDD-------------------EDNKDSLKGDDDQSDSNSNSKKS 286

  Fly   421 CLSG---PKPDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVGLGVGVGVGVGVGLGVSTPLSLAR 482
            | .|   |..|:....|...  |....:.|...::||.|.:.....:..|:...|..||.:|.:.
  Fly   287 C-QGCELPSDDIPDSTSNSR--GHNNNTPSATNNNPSAGNLTPNSSLETGISSNLMGSTTVSASN 348

  Fly   483 SI 484
            .|
  Fly   349 VI 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/51 (63%)
pbNP_476669.3 COG5576 168..274 CDD:227863 44/117 (38%)
Homeobox 202..254 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.