DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and lab

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_476613.1 Gene:lab FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster

Alignment Length:557 Identity:135/558 (24%)
Similarity:191/558 (34%) Gaps:187/558 (34%)


  Fly    10 GEIGTMESPTTRLASKPFPKPFSIESLIANQTPATATPPS------------PPEERDQEQEAE- 61
            |..||...|::...:..:.:..|:.|..|....||..|||            ....:.|:|:|. 
  Fly   135 GNPGTPLHPSSHSPADSYYESDSVHSYYATAAVATVAPPSNSSPITAANASATSNTQQQQQQAAI 199

  Fly    62 ------------------------------QEQELSARAMVASSALGLT---QFPLYNP------ 87
                                          |.:|..|..:.||.|.|:.   |.|:...      
  Fly   200 ISSENGMMYTNLDCMYPTAQAQAPVHGYAGQIEEKYAAVLHASYAPGMVLEDQDPMMQQATQSQM 264

  Fly    88 WLH----------------GYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQPQPP---P 133
            |.|                |..|..|..|.|...|..      |.:|..||||.|.|.|.|   |
  Fly   265 WHHQQHLAGSYALDAMDSLGMHAHMHHGLPHGHLGNL------ANNPHQQQPQVQQQQQQPHQQP 323

  Fly   134 PHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHM 198
            .||...                     :|||                ..|.:.:|:|.:..:...
  Fly   324 QHPQNQ---------------------SPAA----------------HQQHHQNSVSPNGGMNRQ 351

  Fly   199 AAAGRMHEDQANPGMAQLQEPTPPQ-AH--SSPAKSGSHS--------------------PMEPA 240
            ...|.:     :||.:.....:... ||  |:.:||.:||                    |..||
  Fly   352 QRGGVI-----SPGSSTSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPA 411

  Fly   241 LDVGMDEDFECSG--DSC-----SDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRH 298
            ..:....|::.:|  |.|     ....:...|....|.......|..:..:|...::...|....
  Fly   412 SGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSA 476

  Fly   299 EGGGMGGKDSQGNGSSSNSKSRRR----RTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLS 359
            ...|||.....|:|.||.|.|...    ||.||::||.|||:|||..:||:...|.:||.:|:|:
  Fly   477 HPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLN 541

  Fly   360 EVQVKIWFQNRRAKW-KRVKAG------LTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQL 417
            |.||||||||||.|. ||||.|      ||.|         .|.::...|         .|.||.
  Fly   542 ETQVKIWFQNRRMKQKKRVKEGLIPADILTQH---------STSVISEKP---------PQQQQP 588

  Fly   418 EKMCLSGPKPDLRKKLSAEAIGGFEKFSGSTNASSPS 454
            :       .|:|:.|.....:||.|..:|:  .|:|:
  Fly   589 Q-------PPELQLKSQGSDLGGNELATGA--PSTPT 616

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/52 (58%)
labNP_476613.1 Homeobox 505..557 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.