DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and mnx1

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001009885.1 Gene:mnx1 ZFINID:ZDB-GENE-040409-1 Length:311 Species:Danio rerio

Alignment Length:368 Identity:93/369 (25%)
Similarity:120/369 (33%) Gaps:154/369 (42%)


  Fly    29 KPFSIESLIANQTPATATPP------SPPEERDQEQEAEQEQELSARAMVAS---------SALG 78
            |.|.|::|:|...|...|.|      .|........::.|..||:..:....         |:.|
Zfish     5 KNFRIDALLAVDPPKVQTSPLALVTSLPTSSISSSSDSVQAVELTTNSDALQTESPSPPRISSCG 69

  Fly    79 LTQFPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEK 143
            |...|       |:....|..:..|      .|.|..|.|    |||                  
Zfish    70 LIPKP-------GFLNSPHSGMVGL------HPQSSTGIP----PQA------------------ 99

  Fly   144 QLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQ 208
                ...||:.|    ::.||.|..|. |||         .|.|....|                
Zfish   100 ----LYGHPMYT----YSAAALGQHPA-LSY---------SYPHGSHHH---------------- 130

  Fly   209 ANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMD 273
                                     |.|.:|                   :.||.|....:..:.
Zfish   131 -------------------------HHPSDP-------------------LKLTASSFQLDHWLR 151

  Fly   274 KSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNS---KSRRRRTAFTSEQLLELE 335
            .|                       ..|.|..|.:..||.:.::   |.||.||||||:||||||
Zfish   152 VS-----------------------TAGMMLPKMADFNGQAQSNLLGKCRRPRTAFTSQQLLELE 193

  Fly   336 REFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVK 378
            .:|...||||..:|.::||||.|:|.||||||||||.||||.|
Zfish   194 HQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSK 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 35/51 (69%)
mnx1NP_001009885.1 Homeobox 180..233 CDD:278475 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.