DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and Meox1

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_008766312.1 Gene:Meox1 RGDID:1308911 Length:328 Species:Rattus norvegicus

Alignment Length:270 Identity:65/271 (24%)
Similarity:91/271 (34%) Gaps:75/271 (28%)


  Fly   129 PQPPPP------HPPTHALEKQLPPTLPHPLDTRFLPFN-------PAAAGVAPTDLSYRRLAEL 180
            ||||.|      :|  |: |......|||...|   ||:       ||.|  |..|.|...||..
  Rat    12 PQPPAPVWGCLRNP--HS-EGSSASGLPHYPPT---PFSFHQKSDFPATA--AYPDFSTSCLAAT 68

  Fly   181 MNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDV-- 243
                 .|||         ..|.|:..:| :|..     |..|..|...:::|....:.||...  
  Rat    69 -----PHSL---------PRAERIFNEQ-HPAF-----PQTPDWHFPISEAGQRLNLGPAGSARE 113

  Fly   244 -------------GMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYT----NSDSEDCSDD 291
                         |:.||....|....:....:|.|.      |.|:|...    .::.|.|   
  Rat   114 MGAGSPGLVDGTGGLGEDCMVLGTIAHETEKKLSRRK------KERSGQSVVPEPENEVEAC--- 169

  Fly   292 EGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYL-SLTERSQIATS 355
            ||..:|...|.    ..:|....|.|:.|.|.:...:::.|. ||.|...... :||.......:
  Rat   170 EGGSARVPTGA----GPRGWRLCSFSEFRVRCSKDQNQERLN-ERPFQLPPPTPTLTSSGPTQAA 229

  Fly   356 LKLSEVQVKI 365
            ...|.|.||:
  Rat   230 CAHSYVDVKL 239

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 10/44 (23%)
Meox1XP_008766312.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.