DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and Hoxc5

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001101586.1 Gene:Hoxc5 RGDID:1307584 Length:222 Species:Rattus norvegicus

Alignment Length:250 Identity:68/250 (27%)
Similarity:90/250 (36%) Gaps:92/250 (37%)


  Fly   131 PPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPA-AAGVAPTDLSYRRLAELMNQDYVHSLSVHAR 194
            ||.|....|.::....|        |..|..|| :|..||.....|..|..:|.......:....
  Rat    51 PPAPSNSLHGVDMAANP--------RAHPDRPACSAAAAPGHALGRDEAAPLNPGMYSQKAARPA 107

  Fly   195 LQHMA-AAGRMHEDQANPGM-AQL-QEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSC 256
            |:..| ::|.:.|:||..|. |.| |.|.|||.:....|                          
  Rat   108 LEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMTK-------------------------- 146

  Fly   257 SDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRR 321
                |.||                                 ||..|                 :|
  Rat   147 ----LHMS---------------------------------HETDG-----------------KR 157

  Fly   322 RRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            .||::|..|.||||:|||..:||:...|.:||.:|.|:|.|:||||||||.|||:
  Rat   158 SRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKK 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/51 (57%)
Hoxc5NP_001101586.1 COG5373 65..>142 CDD:227665 25/85 (29%)
Homeobox 158..212 CDD:333795 31/54 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.