DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and dlx3b

DIOPT Version :10

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_571397.2 Gene:dlx3b / 30585 ZFINID:ZDB-GENE-980526-280 Length:269 Species:Danio rerio


Alignment Length:117 Identity:42/117 - (35%)
Similarity:59/117 - (50%) Gaps:26/117 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 NGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK 375
            ||..  .|.|:.||.::|.||..|:|.|...:||:|.||:::|..|.|::.||||||||||:|:|
Zfish   119 NGKP--KKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFK 181

  Fly   376 RVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKP 427
            :         |.:||.       ||:.        .|.:......|.|.|.|
Zfish   182 K---------LYKNGE-------VPLE--------HSPNASDSMACNSPPSP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeodomain 324..376 CDD:459649 26/51 (51%)
dlx3bNP_571397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
DLL_N 28..104 CDD:463567
Homeodomain 126..182 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..242 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..269
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.