DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and Gbx1

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001258382.1 Gene:Gbx1 RGDID:621864 Length:425 Species:Rattus norvegicus

Alignment Length:466 Identity:162/467 (35%)
Similarity:190/467 (41%) Gaps:126/467 (27%)


  Fly    41 TPATATPPSPPEERDQE------QEAEQEQELS--ARAMVASSALGLTQFPLYNPWLHGYFAQNH 97
            ||:....|.||.||...      .|....:.|.  ||:....||.|..:.|             .
  Rat     7 TPSPPARPLPPYERGSAAPEPHCAEPAPRRYLGPRARSEPCVSAPGARRGP-------------G 58

  Fly    98 ERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPH-PLDTRFLPFN 161
            ..:.....||....|..:|..........:...||||. ..|.|....|..:|: ||      ..
  Rat    59 SAMQRAAGGGAPGGSGGSGGGPGTAFSIDSLIGPPPPR-SGHLLYTGYPMFMPYRPL------VL 116

  Fly   162 PAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQE--PT---P 221
            |.|...||.......||.|        .|...||.:...||.   .||.|.|..|..  |:   |
  Rat   117 PQALAPAPLPAGLPPLAPL--------ASFAGRLSNTFCAGL---GQAVPSMVALTTALPSFAEP 170

  Fly   222 PQAHSSP-----------AKSGSHSPMEP-------ALDVG----------------------MD 246
            |.|:..|           |.:.|.|..||       |||..                      ..
  Rat   171 PDAYYGPPELAAAAAAAAASTVSRSNPEPPARRTDGALDADELLPAREKVTEPPPPPPPPPPHFS 235

  Fly   247 EDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSR-----HEGGGMGG- 305
            |.|.         ||....:.|:.:.:|....|...:.||...:..|..|.     ...||.|. 
  Rat   236 ETFP---------SLPAEGKVYSSDEEKLEPPAGEPAGSEPEEEGSGGDSEDSFLDSSAGGPGAL 291

  Fly   306 -------KDSQGNGSSSNS-----------KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQI 352
                   |.|.|.|:...:           ||||||||||||||||||:|||.||||||||||||
  Rat   292 LGPKPKLKGSLGTGAEEGTPVATGVTTPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQI 356

  Fly   353 ATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNG-TTSGTKIVVPIPVHVNRFAVRSQHQQ 416
            |.:|||||||||||||||||||||:|||..|   .|:| .....|||||||||||||||||||||
  Rat   357 AHALKLSEVQVKIWFQNRRAKWKRIKAGNVS---SRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQ 418

  Fly   417 LEKMCLSGPKP 427
            :|:    |.:|
  Rat   419 MEQ----GARP 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 47/51 (92%)
Gbx1NP_001258382.1 Homeobox 326..379 CDD:278475 49/53 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260501367
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 176 1.000 Inparanoid score I3887
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002838
OrthoInspector 1 1.000 T618060
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24334
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
87.940

Return to query results.
Submit another query.