DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and Gbx1

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_056554.1 Gene:Gbx1 MGIID:95667 Length:418 Species:Mus musculus

Alignment Length:455 Identity:164/456 (36%)
Similarity:198/456 (43%) Gaps:111/456 (24%)


  Fly    41 TPATATPPSPPEERDQE------QEAEQEQELS--ARAMVASSALGLTQFPLYNPWLHGYFAQNH 97
            ||.....|.||.||:..      .|....:.|.  ||:....||.|..:.|       |...|. 
Mouse     7 TPNPPARPLPPYERESAAPEPHCAEPAPRRHLGPRARSEPCVSARGARRGP-------GSAMQR- 63

  Fly    98 ERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQP-----QPPPPHPPTHALEKQLPPTLPH-PLDTR 156
                  .|||    .:|.|...:......|..     .||||. ..|.|....|..:|: ||   
Mouse    64 ------AAGG----GAPGGSGGSSGGPGAAFSIDSLIGPPPPR-SGHLLYTGYPMFMPYRPL--- 114

  Fly   157 FLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQL----- 216
               ..|.|...||.......||.|        .|...||.:...||.   .||.|.|..|     
Mouse   115 ---VLPQALAPAPLPAGLPPLAPL--------ASFAGRLSNTFCAGL---GQAVPSMVALTTALP 165

  Fly   217 --QEPT-----PPQAHSSPAKSGSHSPMEPA---LDVGMD-EDFECSGDSCSD------------ 258
              .||.     ||:..::.|.:.|.|..|||   .|..:| |:...:.:..::            
Mouse   166 SFAEPPDAYYGPPELAAAAASTASRSNPEPAARRTDGALDAEELLPAREKVTEPPPPPPPHFSET 230

  Fly   259 -ISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSR-----HEGGGMGG--------KDSQ 309
             .||....:.|:.:.:|....|...:.||...:..|..|.     ...||.|.        |.|.
Mouse   231 FPSLPAEGKVYSSDEEKLEPPAGDPAGSEQEEEGSGGDSEDSFLDSSAGGPGALLGPKPKLKGSP 295

  Fly   310 GNGSSSNS-----------KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQV 363
            |.|:...:           ||||||||||||||||||:|||.|||||||||||||.:||||||||
Mouse   296 GTGAEEGTPVATGVTTPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQV 360

  Fly   364 KIWFQNRRAKWKRVKAGLTSHGLGRNG-TTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKP 427
            |||||||||||||:|||..|   .|:| .....|||||||||||||||||||||:|:    |.:|
Mouse   361 KIWFQNRRAKWKRIKAGNVS---SRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQ----GARP 418

  Fly   428  427
            Mouse   419  418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 47/51 (92%)
Gbx1NP_056554.1 Homeobox 319..372 CDD:278475 49/53 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260501536
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 176 1.000 Inparanoid score I4017
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002838
OrthoInspector 1 1.000 T615946
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24334
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4817
TreeFam 1 0.960
98.970

Return to query results.
Submit another query.