DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and mls-2

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_508815.2 Gene:mls-2 WormBaseID:WBGene00003377 Length:341 Species:Caenorhabditis elegans

Alignment Length:341 Identity:85/342 (25%)
Similarity:128/342 (37%) Gaps:96/342 (28%)


  Fly   188 SLSVHARLQHMAAAGRM------HEDQANPGMAQ---------LQEPTPPQAHSSPAKSGSHSPM 237
            ::|...||:.|:...::      .|::..|....         |::...|...|||:.|...|..
 Worm    14 TMSSQERLEKMSQLPKIELMEEEEEEEMKPSSDNKIKFNISELLEDDRKPTTQSSPSASSEDSTN 78

  Fly   238 E-----------PALD-----VGMDEDFECSGDSCSDIS-LTMSP-------------------- 265
            |           |.::     :.:.:.|...|:..:.|| |||.|                    
 Worm    79 EIEQTAFNFNFDPKMNPISALLQLQQTFLNVGNQQNMISPLTMFPFFGLPTAQLMHFKNMSNPDV 143

  Fly   266 --------------RNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSS-S 315
                          ...:||...|..|:...||:|| .||.|.          |.|.:.|.|. |
 Worm   144 NIQSDNGEEKDEKSEGKDGETRDSTGGSPLESDAED-DDDIGR----------GSDDEANSSDPS 197

  Fly   316 NSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR---- 376
            .::.::.||.|:..|:.:||..|..|:|||..|||.:|..|.|:|.||||||||||.|:||    
 Worm   198 QNRKKKTRTVFSRSQVSQLEMMFECKRYLSSQERSNLAQKLHLTETQVKIWFQNRRNKFKRQAQT 262

  Fly   377 --VKAGLTSHG---LGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAE 436
              ....|..|.   .....||:.|..::.||.......:|:.        :|.|. |.....:|.
 Worm   263 DDTNISLQMHRANVFSIPATTALTSPILTIPTTSAGVNMRNM--------ISSPM-DASATAAAR 318

  Fly   437 AIGGFEKFSGSTNASS 452
            .:.||.......|.::
 Worm   319 FLFGFGTLQAQQNLNA 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/51 (55%)
mls-2NP_508815.2 Homeobox 204..257 CDD:278475 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.