DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and gbx1

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_777286.1 Gene:gbx1 ZFINID:ZDB-GENE-020117-2 Length:316 Species:Danio rerio

Alignment Length:338 Identity:136/339 (40%)
Similarity:166/339 (49%) Gaps:80/339 (24%)


  Fly   129 PQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRR-------LAELMNQDYV 186
            |||    .|.|.|....|         .|:|:.|.   :.|..||:..       ||.|      
Zfish    20 PQP----RPGHLLYTGYP---------MFMPYRPL---MIPQALSHSSLPSGIPPLAPL------ 62

  Fly   187 HSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPME-PALDVGMD---- 246
              .|...||.:...||.   .|..|.|..|....|  :.|.|..| .:.|.| |...:|.|    
Zfish    63 --ASFAGRLTNTFCAGL---GQGMPSMVALTTTLP--SFSDPPDS-FYPPQEMPGPRLGADGTGM 119

  Fly   247 ------EDFECSGDSCSDISLTM-----SPRNYNGEMDK-----------SRNGAYTNSDSEDCS 289
                  .| |..|....:.:.|.     ..:.|:.:.:|           .|..:..:|::|..|
Zfish   120 NRQESPHD-ELKGSELLNFTETFQAVAGETKLYSSDDEKLDLKAAEAACSDREDSSADSENESFS 183

  Fly   290 DDEGAQSRHEGGGM--GGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQI 352
            |.....|..:.|.:  |.:|:...|.|: .||||||||||||||||||:|||.||||||||||||
Zfish   184 DGNTCASASQKGKLKGGSQDALPPGGSA-GKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQI 247

  Fly   353 ATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLG---RNGTTSGTKIVVPIPVHVNRFAVRSQH 414
            |.:|||||||||||||||||||||:|||..::..|   ||     .|||||||||||||||||||
Zfish   248 AHALKLSEVQVKIWFQNRRAKWKRIKAGNVNNRSGEPVRN-----PKIVVPIPVHVNRFAVRSQH 307

  Fly   415 QQLEKMCLSGPKP 427
            ||:|    .|.:|
Zfish   308 QQIE----PGSRP 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 47/51 (92%)
gbx1NP_777286.1 Homeobox 217..270 CDD:278475 49/53 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260499450
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I4001
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002838
OrthoInspector 1 1.000 T596699
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24334
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4817
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.