DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and Hoxa1

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_037207.2 Gene:Hoxa1 RGDID:2812 Length:334 Species:Rattus norvegicus

Alignment Length:415 Identity:107/416 (26%)
Similarity:144/416 (35%) Gaps:146/416 (35%)


  Fly    70 AMVASSALGLTQF----------------------PLYNPWLHGYFAQNHERLTHLIAGG---CY 109
            |.|.||..|:|.|                      .:.:|..|.:...:.:..|:..:|.   .|
  Rat    25 ARVYSSDHGITTFQSCAVSANSCGGDDRFLGGRGVQITSPHHHHHHHHHPQPATYQTSGNLGVSY 89

  Fly   110 LPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSY 174
            ..||......||...|        |:.| :.|.::...:..:|         |.|..|...:|| 
  Rat    90 SHSSCGPSYGAQNFSA--------PYGP-YGLNQEADVSGGYP---------PCAPAVYSGNLS- 135

  Fly   175 RRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEP 239
                ..|.|.:.|         |...||      ...|..|....:..|.|.|.|.:..::.:.|
  Rat   136 ----SPMVQHHHH---------HQGYAG------GTVGSPQYIHHSYGQEHQSLALATYNNSLSP 181

  Fly   240 ALDVGMDEDFECSGDSC-SDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGM 303
             |.....|       :| |..|.|.||......|...||...|                   |.:
  Rat   182 -LHASHQE-------ACRSPASETSSPAQTFDWMKVKRNPPKT-------------------GKV 219

  Fly   304 G--GKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIW 366
            |  |...|.|..         ||.||::||.|||:|||..|||:...|.:||.||:|:|.|||||
  Rat   220 GEYGYVGQPNAV---------RTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIW 275

  Fly   367 FQNRRAKW-KRVKAGLTSHGLGRNGTTSGTKIVVPI-PVHVNRFAVRSQHQQLEKMCLSGPKPDL 429
            |||||.|. ||.|.||                 :|| |.                   :.|..|.
  Rat   276 FQNRRMKQKKREKEGL-----------------LPISPA-------------------TPPGSDE 304

  Fly   430 RKKLSAEAIGGFEKFSGSTNASSPS 454
            :.:.|:      ||.|.|.:|.||:
  Rat   305 KTEESS------EKSSSSPSAPSPA 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/52 (62%)
Hoxa1NP_037207.2 Interaction with OGT. {ECO:0000250|UniProtKB:P09022} 74..202 38/174 (22%)
COG5576 175..>285 CDD:227863 51/146 (35%)
Antp-type hexapeptide 203..208 1/5 (20%)
Homeobox 232..284 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.