DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and Hoxa3

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001300749.1 Gene:Hoxa3 RGDID:1561431 Length:444 Species:Rattus norvegicus

Alignment Length:433 Identity:104/434 (24%)
Similarity:146/434 (34%) Gaps:171/434 (39%)


  Fly    84 LYNPWLHGYFAQNHERLTHLIAGGCYL-----PSSP--AGHPAAQQPQAQA-----QPQPPPPHP 136
            |.:|...|...::||     ::..|..     ||.|  .|.|....|..||     ||..|||.|
  Rat    53 LQSPASAGAHPKSHE-----LSEACLRTLSGPPSQPPGLGDPPLPPPPPQAAPPAPQPPQPPPQP 112

  Fly   137 PTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAA 201
            |........||:...|         |.:|...||..|..: :.|:|...|               
  Rat   113 PAPTPAAPPPPSSVSP---------PQSANSNPTPASTAK-SPLLNSPTV--------------- 152

  Fly   202 GRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPR 266
            |:    |..|.|.:.::.|..:.      |||                 .||:||:         
  Rat   153 GK----QIFPWMKESRQNTKQKT------SGS-----------------SSGESCA--------- 181

  Fly   267 NYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQL 331
                                                 |.|...|..|     |:|.|||:||.||
  Rat   182 -------------------------------------GDKSPPGQAS-----SKRARTAYTSAQL 204

  Fly   332 LELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAG---LTSHGLGRNGTTS 393
            :|||:|||..:||....|.::|..|.|:|.|:||||||||.|:|:.:.|   |||.| |::.:.|
  Rat   205 VELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGKGMLTSSG-GQSPSRS 268

  Fly   394 GTKIVVPIPVHVNRFAVRSQHQQLEKM-------------------------------CLSGPKP 427
                  |:|.....: :.|.|..:..:                               |...|.|
  Rat   269 ------PVPPGAGGY-LNSMHSLVNSVPYEPQSPPPFSKPPQGAYGLPPASYPAPLPSCAPPPPP 326

  Fly   428 DLRKKLSAEAIGGFEKF---------SGSTNASSPSGGPVGLG 461
            ..|...:....||..::         :||.......|.||.:|
  Rat   327 QKRYTAAGSGAGGTPEYDPHAHGLQGNGSYGTPHLQGSPVFVG 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/51 (57%)
Hoxa3NP_001300749.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.