DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and Hoxa2

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_036713.2 Gene:Hoxa2 RGDID:2813 Length:372 Species:Rattus norvegicus

Alignment Length:387 Identity:93/388 (24%)
Similarity:134/388 (35%) Gaps:142/388 (37%)


  Fly   147 PTLPHPLDTRFLPFNPAA-----AGVAPTDLSYRRLAELMNQDYVHSLS--VHARLQHMAAAGRM 204
            |:|...|.:    |.|.|     :.:..:.||:..|.....:..:.||:  .|.| |...|.|| 
  Rat    16 PSLAECLTS----FPPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPR-QSAGAGGR- 74

  Fly   205 HEDQANPGMAQLQEPTPPQAHSSP-------AKSGSHSPMEPALDVGMDEDFECSGDSCSDISLT 262
              .:::|..:: ..|.|.:|...|       .|:...:.:.||.        ..:|.:|      
  Rat    75 --PKSSPAGSR-GSPVPARALQPPEYPWMKEKKAAKKTALPPAA--------ASTGPAC------ 122

  Fly   263 MSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFT 327
                                                    :|.|:|......|...|||.|||:|
  Rat   123 ----------------------------------------LGHKESLEIADGSGGGSRRLRTAYT 147

  Fly   328 SEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR---VKAGLTSHG---- 385
            :.||||||:|||..|||....|.:||..|.|:|.|||:||||||.|.||   .|....|.|    
  Rat   148 NTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNSEGKFKN 212

  Fly   386 ---------------------------LGRNGTT---------------SGTKIVVPI-PVHVNR 407
                                       |.|.|.|               :|.....|: |:..|.
  Rat   213 LEDSDKVEEDEEEKSLFEQALSVSGALLEREGYTFQQNALSQQQAPNGHNGDSQTFPVSPLTSNE 277

  Fly   408 FAVRS-QHQQ---------LEKMCLSGPKPDLRKKLSAEAIGGFEKFSGS-----TNASSPS 454
            ..::. |||.         :.:.|.:|...|..:.|...::..|..||..     ::|.|||
  Rat   278 KNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQDFNVFSTDSCLQLSDALSPS 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)
Hoxa2NP_036713.2 Antp-type hexapeptide 96..101 0/5 (0%)
Homeobox 143..195 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.