DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and LOC100909604

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_008761166.1 Gene:LOC100909604 RGDID:6502601 Length:304 Species:Rattus norvegicus

Alignment Length:140 Identity:50/141 (35%)
Similarity:69/141 (49%) Gaps:18/141 (13%)


  Fly   253 GDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSE-----DCSDDEGAQSRHEGG----------- 301
            |.||......:|..:.:|...:...|.|.:...|     |.|..:| ::.||.|           
  Rat   146 GASCFYSDKDLSGASPSGNSKQRGPGDYLHFSPEQQYKPDSSSVQG-KALHEEGTDRKYTSPVYP 209

  Fly   302 GMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIW 366
            .|...:|.. |:...|..||.|..:|..|.||||:|||..:||:...|.:||.:|.|:|.|:|||
  Rat   210 WMQRMNSCA-GAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIW 273

  Fly   367 FQNRRAKWKR 376
            |||||.|||:
  Rat   274 FQNRRMKWKK 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/51 (55%)
LOC100909604XP_008761166.1 Homeobox 230..282 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.