DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxb7

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002938071.2 Gene:hoxb7 XenbaseID:XB-GENE-5959293 Length:216 Species:Xenopus tropicalis

Alignment Length:165 Identity:52/166 (31%)
Similarity:76/166 (46%) Gaps:21/166 (13%)


  Fly   226 SSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSED--- 287
            |:|.:||..|  .|............||.|....|..|...:|.  :|.:....:.:...::   
 Frog    36 SNPQRSGYGS--SPGSTFPAGSALYSSGSSLHPQSPAMYSSSYG--LDAASFNMHCSPFEQNLSL 96

  Fly   288 -CSDDEGAQSRHEGGGMGGKDSQGNGS----------SSNSKSRRRRTAFTSEQLLELEREFHAK 341
             |..|   .|:..|.....:||:..|.          |:.:..:|.|..:|..|.||||:|||..
 Frog    97 MCPTD---PSKQNGTKAEQRDSELQGDTNLRIYPWMRSTGADRKRGRQTYTRYQTLELEKEFHFN 158

  Fly   342 KYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            :||:...|.:||.:|.|:|.|:||||||||.|||:
 Frog   159 RYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/51 (55%)
hoxb7XP_002938071.2 COG5576 87..>198 CDD:227863 39/111 (35%)
Homeobox 140..192 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.