DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxb8

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002938067.1 Gene:hoxb8 XenbaseID:XB-GENE-990961 Length:243 Species:Xenopus tropicalis

Alignment Length:195 Identity:53/196 (27%)
Similarity:82/196 (42%) Gaps:51/196 (26%)


  Fly   199 AAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTM 263
            |:||...:   :||  |:|:    ..|.:|:.|.......|..       ..|.||         
 Frog    42 ASAGGTFQ---HPG--QIQD----FYHGTPSLSSPTYQQNPCA-------VTCHGD--------- 81

  Fly   264 SPRNYNGEMDKSRNGAYTNSDSE-----DCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSK----- 318
             |.::.|.....|...:::.|:|     :|        :....|:|.:......|.|.::     
 Frog    82 -PGSFYGYDPLQRQSLFSSQDTELVQYSEC--------KLASAGLGEEAESSEQSPSPTQLFPWM 137

  Fly   319 -------SRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
                   .||.|..::..|.||||:||....||:...|.:::.:|.|:|.||||||||||.|||:
 Frog   138 RPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKK 202

  Fly   377  376
             Frog   203  202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/51 (49%)
hoxb8XP_002938067.1 Homeobox 149..201 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.