DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and pdx1

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002934065.1 Gene:pdx1 XenbaseID:XB-GENE-483331 Length:271 Species:Xenopus tropicalis

Alignment Length:273 Identity:71/274 (26%)
Similarity:106/274 (39%) Gaps:80/274 (29%)


  Fly   109 YLPSSPA-GHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDL 172
            |.|.:|. ..|.|.| ::|||...|.| |....:.:|......:||    :..:|.    :|.|:
 Frog     7 YYPQAPLYKEPCAFQ-RSQAQDYNPSP-PACLYMGRQQQAAYSNPL----VALDPG----SPPDI 61

  Fly   173 SYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPM 237
            |...:..:..:..|..|..|   .|       |....:||:     |.|.|....|         
 Frog    62 SPYEVPPISEEPIVPHLHHH---HH-------HHHHHHPGI-----PHPHQQMPFP--------- 102

  Fly   238 EPALDVGMDEDFECSGDSCSDISLTMSPRNYN----GEMDKSRNGAYTNSDSEDCSDDEGAQSRH 298
                     :|.|         |.|:..||..    ..|..:::..:.                 
 Frog   103 ---------DDTE---------SATLEERNRTLLPFPWMKSTKSHTWK----------------- 132

  Fly   299 EGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQV 363
                  |:.:.|:......:::|.|||:|..||||||:||...||:|...|.::|..|.|:|..:
 Frog   133 ------GQWTGGSYIMEQEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHI 191

  Fly   364 KIWFQNRRAKWKR 376
            ||||||||.|||:
 Frog   192 KIWFQNRRMKWKK 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/51 (57%)
pdx1XP_002934065.1 Homeobox 150..203 CDD:278475 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.