DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxc10

DIOPT Version :10

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001258236.1 Gene:hoxc10 / 100487723 XenbaseID:XB-GENE-486915 Length:351 Species:Xenopus tropicalis


Alignment Length:54 Identity:13/54 - (24%)
Similarity:24/54 - (44%) Gaps:15/54 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 IITQKVTSLAFSIHDGFTREMKD----------LTQSQQQHAI---RKLPSPLE 183
            ::.:..|.:  |:::.||..:|:          ..|.|||.|.   |:|...:|
 Frog     9 VVLKSTTKM--SLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQME 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeodomain 324..376 CDD:459649
hoxc10NP_001258236.1 Homeodomain 278..334 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.