DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxc10

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001258236.1 Gene:hoxc10 XenbaseID:XB-GENE-486915 Length:351 Species:Xenopus tropicalis

Alignment Length:350 Identity:79/350 (23%)
Similarity:129/350 (37%) Gaps:106/350 (30%)


  Fly    66 LSARAMVASSALGLTQFPLY----NPWLHGYFAQNHERLTHLIA---GGCYLPSS---------- 113
            ||.|..|.:..|.|..:|.|    :.|..   .:|..|:...:|   ..|..|::          
 Frog    54 LSKRDDVNNPGLSLNTYPSYLSQLDSWCE---PKNTYRIEQPVARQLSSCSFPTNVKEENVCCMY 115

  Fly   114 PAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLA 178
            .....|....:|...|.   ..|.|.:.:.::|           :|             ||.|.:
 Frog   116 STDKRAKNATEAALYPN---QMPETRSSDHEVP-----------VP-------------SYYRAS 153

  Fly   179 ELMNQD--------------YVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPA 229
            :..:.:              :.:..||.||.:.:       |.|...|.....|.|         
 Frog   154 QGYSMEKTPSCHTTGDFETTFENRTSVSARSEIL-------EQQQAGGKGGFPENT--------- 202

  Fly   230 KSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMS-------PRNYNGEMDKSRNGAYTNSDSED 287
            |:.:.|         :..:...|..:.|||....|       |...:.|..|:.:.:..|||:|.
 Frog   203 KTDNQS---------LATNLTTSSATASDIKTEKSLPAPKLPPSEGDKEPSKNTDTSTDNSDAEA 258

  Fly   288 CSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQI 352
            ..|            :..:::.||..::.| .|::|..:|..|.||||:||....||:...|.:|
 Frog   259 KED------------IKAENAAGNWLTAKS-GRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEI 310

  Fly   353 ATSLKLSEVQVKIWFQNRRAKWKRV 377
            :.|:.|::.||||||||||.|.|::
 Frog   311 SKSINLTDRQVKIWFQNRRMKLKKM 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/51 (49%)
hoxc10NP_001258236.1 COG5576 227..>340 CDD:227863 40/122 (33%)
Homeobox 280..333 CDD:278475 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.