DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and gbx2.1

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002932046.1 Gene:gbx2.1 XenbaseID:XB-GENE-855771 Length:340 Species:Xenopus tropicalis

Alignment Length:426 Identity:142/427 (33%)
Similarity:183/427 (43%) Gaps:119/427 (28%)


  Fly    18 PTTRLASKPF--PKPFSIESLIANQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLT 80
            |...:..:|.  ...|||:|||       .:||.|                      :......|
 Frog     7 PPLMMMQRPLGSSTAFSIDSLI-------GSPPQP----------------------SPGHFVYT 42

  Fly    81 QFPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQL 145
            .:|::.|:                            .|..         .||||.||....:..|
 Frog    43 GYPMFMPY----------------------------RPVV---------LPPPPPPPPSLSQATL 70

  Fly   146 PPTLPHPLDTRFLPFNPA------AAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRM 204
            .||||.......:|..|:      |.|:|.|.                  ::.|.|....:|...
 Frog    71 QPTLPSAHPHHQIPSLPSGFCSSLAQGMALTS------------------TLMATLPGGFSASAQ 117

  Fly   205 HEDQANP-GMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNY 268
            |::.|.. |...||       .:.....|..|..|......:.::......|.|::||  .|...
 Frog   118 HQEAARKFGAQSLQ-------GAFEKSDGGQSDGEDGNKTYITKEGTLLPFSASEVSL--GPVRG 173

  Fly   269 NGEMD-------KSRNGAY-TNSDSEDCSDDE-GAQSRH------EGGGMGGKDSQGNGSSSNSK 318
            .|:.:       |.:..:| .:||.:..|||. ..|:.|      |........|..:.:||..|
 Frog   174 QGKEESGKEAEGKGKEDSYLMDSDLDYSSDDNISCQTAHKEDDTPEESPPNSNPSNNSNTSSTGK 238

  Fly   319 SRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTS 383
            :||||||||||||||||:|||.|||||||||||||.:|||||||||||||||||||||||||..:
 Frog   239 NRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNAN 303

  Fly   384 HGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEK 419
            ...|.  .:...||||||||||:|||:||||||||:
 Frog   304 SKTGE--PSRNPKIVVPIPVHVSRFAIRSQHQQLEQ 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 47/51 (92%)
gbx2.1XP_002932046.1 Homeobox 242..295 CDD:278475 49/53 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260493016
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002838
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4817
TreeFam 1 0.960
54.820

Return to query results.
Submit another query.