DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxd8

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001135589.1 Gene:hoxd8 XenbaseID:XB-GENE-920113 Length:231 Species:Xenopus tropicalis

Alignment Length:265 Identity:68/266 (26%)
Similarity:88/266 (33%) Gaps:104/266 (39%)


  Fly   165 AGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPA 229
            :|.||  |.|........|||.|                      :||       |.|.....||
 Frog    32 SGRAP--LVYSGSGSGAPQDYYH----------------------HPG-------TLPSPGYQPA 65

  Fly   230 KSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAY-TNSDSE-----DC 288
            ..|                ..|.||          |....|.....|...: |:.::|     ||
 Frog    66 PCG----------------ITCHGD----------PAKLYGYDHFQRQHIFTTHQEAEPVQYPDC 104

  Fly   289 ---SDDEGAQSRHEGGGMGGKDSQGNGSSSN---------SKSRRR-RTAFTSEQLLELEREFHA 340
               |...||...|         ...|..:|:         :..||| |..::..|.||||:||..
 Frog   105 KSPSASIGADPEH---------LHQNSPASHMFPWMRAQVAPGRRRGRQTYSRFQTLELEKEFLF 160

  Fly   341 KKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR-------------------VKAGLTSHGL 386
            ..||:...|.:::.:|.|:|.||||||||||.|||:                   .|.||.....
 Frog   161 NPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENSKDKFPVSSQEGKEEADKKGGLHQEQQ 225

  Fly   387 GRNGT 391
            ||.|:
 Frog   226 GREGS 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/51 (49%)
hoxd8NP_001135589.1 NADB_Rossmann <73..>140 CDD:304358 16/86 (19%)
Homeobox 143..195 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.