DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxa3

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001120901.1 Gene:hoxa3 XenbaseID:XB-GENE-482267 Length:406 Species:Xenopus tropicalis

Alignment Length:327 Identity:86/328 (26%)
Similarity:136/328 (41%) Gaps:71/328 (22%)


  Fly   139 HALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGR 203
            :|.::|.||: ...|:|.:  ..||.:..:|........|..:|:..:.:::..:.     .|..
 Frog    27 NASQQQYPPS-SSLLETEY--HRPACSLQSPGSAVPHHKANDINESCMRTINSQSN-----QAPV 83

  Fly   204 MHEDQANPGMAQLQEP----TPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMS 264
            :.|.|..|     |.|    :|||..|:.|.:.|:.                   :.|..|.|||
 Frog    84 IPEQQPTP-----QGPPPSVSPPQTTSNAATASSNK-------------------ATSITSPTMS 124

  Fly   265 PRNYNGEMDKSRNG-----AYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRT 324
            .:.:.. |.:||..     |.::|..|.|:.|:....:                   |.|:|.||
 Frog   125 KQIFPW-MKESRQNTKQQKAGSSSSGESCAGDKSPPGQ-------------------SSSKRART 169

  Fly   325 AFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAG---LTSHGL 386
            |:||.||:|||:|||..:||....|.::|..|.|:|.|:||||||||.|:|:.:.|   :||.| 
 Frog   170 AYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGKSMMTSSG- 233

  Fly   387 GRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSGSTNAS 451
            |::...|      |:|.......:.|.|..:..:......|....|....|.|....:....|:.
 Frog   234 GQSPCRS------PVPTPSVGGYLNSMHSLVNSVPYEPQSPPAFNKHHPSAYGVPAPYPSPHNSC 292

  Fly   452 SP 453
            .|
 Frog   293 PP 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/51 (57%)
hoxa3NP_001120901.1 Homeobox 168..220 CDD:278475 30/52 (58%)
DUF4074 343..404 CDD:290032
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.