DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxb2

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002938064.2 Gene:hoxb2 XenbaseID:XB-GENE-478525 Length:436 Species:Xenopus tropicalis

Alignment Length:258 Identity:65/259 (25%)
Similarity:84/259 (32%) Gaps:110/259 (42%)


  Fly   149 LPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPG- 212
            :|.|.:......||.:                       ...:..:.|..|..|.:.:.|..|| 
 Frog   139 IPPPFEQTIPSLNPGS-----------------------DSQIRPKSQKRAENGLLQQPQVQPGH 180

  Fly   213 ------------MAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSP 265
                        .|:......|||...|.:|...||.||.   |:                    
 Frog   181 LATEFPWMKEKKSAKKSSQGSPQALIPPPESAGGSPAEPP---GL-------------------- 222

  Fly   266 RNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQ 330
                                            |:.||               .|||.|||:|:.|
 Frog   223 --------------------------------HDAGG---------------GSRRLRTAYTNTQ 240

  Fly   331 LLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTS 393
            |||||:|||..|||....|.:||..|.|:|.|||:||||||.|.||    .|.|...::|..|
 Frog   241 LLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKR----QTQHKDSQDGEHS 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)
hoxb2XP_002938064.2 Homeobox 233..285 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.