DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxa2

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_004915456.1 Gene:hoxa2 XenbaseID:XB-GENE-488087 Length:373 Species:Xenopus tropicalis

Alignment Length:191 Identity:62/192 (32%)
Similarity:86/192 (45%) Gaps:30/192 (16%)


  Fly   209 ANPGMAQLQEPTPP-----QAHSSPAKSGSHS-----PME---PALDVGMD-----EDFECSGDS 255
            :.|.:|:.....||     |:.|..:.:.|||     |.|   |:|:.|..     .....:|..
 Frog    14 SQPSLAECLTSFPPVGDTFQSSSIKSSALSHSTLIPPPFEQTIPSLNPGSHPRHSRPKHSPNGHG 78

  Fly   256 CSDISLTMSPRNYNGEMDKSRN-----GAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSS 315
            .|.:.....|..|....:|..:     .|.|.:.:...:....|...|       |:......:|
 Frog    79 DSPVPAGSLPPEYPWMKEKKASKKAPIAAATAAAAASAAPATTACLSH-------KEIIEIQDNS 136

  Fly   316 NSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            :..|||.|||:|:.||||||:|||..|||....|.:||..|.|:|.|||:||||||.|.||
 Frog   137 SGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKR 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)
hoxa2XP_004915456.1 Homeobox 144..196 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.