DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unpg and hoxd10

Sequence 1:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002935721.1 Gene:hoxd10 XenbaseID:XB-GENE-485204 Length:338 Species:Xenopus tropicalis

Alignment Length:391 Identity:94/392 (24%)
Similarity:145/392 (37%) Gaps:111/392 (28%)


  Fly    24 SKPFPKPFSIESLIA--------NQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSAL-GL 79
            |.|....|.::|||:        :.:.:...|||              .||....|.....| .|
 Frog     6 SSPAANTFLVDSLISACRSDSFYSNSASMYMPPS--------------TELGTYGMQTCGLLPSL 56

  Fly    80 TQFPLYNPWLHGYFAQNHERL---THLIAGGCYLP-----SSPAGHPAAQQPQAQAQPQPPPPHP 136
            .:..:           ||:.:   .|     .|:|     :.|:.....:||..|   |.|....
 Frog    57 AKREV-----------NHQNMGMNVH-----PYIPQVDSWTDPSRSCRIEQPVTQ---QLPTCSF 102

  Fly   137 PTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTD-LSYRRL----AELMNQDYVHSLSVHARLQ 196
            ||:..|           :|....::...:.|...: .||:||    ..:.|.:.  .:..:.||.
 Frog   103 PTNIKE-----------ETNCCMYSDKRSKVISAEGPSYQRLVPDNCPVENSEV--PVPGYFRLS 154

  Fly   197 HMAAAGRMHEDQANPG-----MAQLQEPT------PPQAHSSPAKSGSHSPMEPALDVGMDEDFE 250
            ...|.|:..|...||.     |.||...|      |||.|..  |..:.:|.      ..|....
 Frog   155 QSYATGKPQEYNNNPESSSSLMLQLNPRTSSKQQIPPQLHMD--KKMNENPS------SQDSGKV 211

  Fly   251 CSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSS 315
            .||:|....:.....|:...|:..|         |.:..|.|..:           :.:.:..:|
 Frog   212 PSGESPDPKAAHQEDRSCLAEVSVS---------SPEVQDKETKE-----------EIKSDTPTS 256

  Fly   316 N---SKS-RRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            |   :|| |::|..:|..|.||||:||....||:...|.:|:.|:.|::.||||||||||.|.|:
 Frog   257 NWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKK 321

  Fly   377 V 377
            :
 Frog   322 M 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/51 (49%)
hoxd10XP_002935721.1 Homeobox 267..320 CDD:278475 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.