DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and rad51d

DIOPT Version :8

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001005687.1 Gene:rad51d / 448189 XenbaseID:XB-GENE-1014974 Length:320 Species:Xenopus tropicalis

Alignment Length:313 Identity:77/314 (25%)
Similarity:137/314 (44%) Gaps:77/314 (25%)


  Fly    11 CTGRLLSEYQLNLLRKNNICSLIDFYDADEKKLHELWAIN---IQSVR----------------- 55
            |.|  ||...:.:|:.||:.::||...:|.::|....:::   :.:||                 
 Frog     9 CPG--LSAGIVAVLKANNVKTVIDLVASDLEELARKCSLSYKTLMAVRRVLLAQYSAFPSSGADV 71

  Fly    56 --ELKKELSLLPKGSVDEGTPDFNYDTGIEELDKLLDSVEQPFKPGRVWELCGQPGVGKTQLLYT 118
              |||...::||              ||..:||.||||   ....|.|.|:.|..|.||||...:
 Frog    72 YEELKSSTAILP--------------TGNRKLDILLDS---GLYTGEVTEIAGAAGSGKTQTCQS 119

  Fly   119 LALNFVWKHSQAVLFIDTKREFSCKRIQDMLRAREVDEEASERAMKGIRVVQAATGADINDLLKS 183
            :|:|..:...|.||::||....:..|:..::::|...|:....:::.|.|::      :.|:.|.
 Frog   120 IAVNVAYNLKQTVLYVDTTGGLTASRLLQLVQSRTKSEDEQVASLQRIEVIR------VFDIYKL 178

  Fly   184 FD------HQLTAETHASMQ-TKLVLIDSL-AACFAFYRGRRMRDVRKSVLTELACKIRKLAL-R 239
            ||      ||::.:...|.: .:||::||: |..:....|:....:  :::.:||.:::.||. .
 Frog   179 FDAFQDLRHQISQQLLRSGEPLRLVIVDSVCAVIYPMLGGKHTEGM--AIMMQLARELQTLAHDY 241

  Fly   240 GVAFVIGNVSFFENNKDSCGDDGEQNGDDEEVTRQQLEPMLGSYWSSVATLRL 292
            .:|.:|.|         |...||....          .|.||..||.|.:.|:
 Frog   242 HLAILISN---------SITKDGATGN----------RPALGRSWSFVPSTRI 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 59/223 (26%)
radB 80..335 CDD:236482 59/223 (26%)
rad51dNP_001005687.1 RecA-like_NTPases 82..298 CDD:333705 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1214879at2759
OrthoFinder 1 1.000 FOG0007565
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4853
TreeFam 1 0.960
76.820

Return to query results.
Submit another query.