DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and rad51b

DIOPT Version :8

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_998577.1 Gene:rad51b / 406721 ZFINID:ZDB-GENE-040426-2750 Length:373 Species:Danio rerio

Alignment Length:371 Identity:86/372 (23%)
Similarity:147/372 (40%) Gaps:85/372 (23%)


  Fly     8 LQTCTGRLLSEYQLNLLRKNNICSLIDFYDADEKKLHELWAINIQSVRELKKELSLLPKGSVD-- 70
            |:||.. :||..|:.|.|...:.     |.|         |:|:|  |.:.|..:.....::|  
Zfish    24 LETCQD-VLSVTQVELSRLAGLS-----YPA---------ALNLQ--RLVSKACAPAVITALDLW 71

  Fly    71 EGTPDFNYDTGIEELDKLLDSVEQPFKPGRVWELCGQPGVGKTQLLYTLALNFVWKHS-----QA 130
            :...:..:.|.:..||:||..   ....|.:.|:.|..|.|||||...|::......|     ..
Zfish    72 KRKEELCFSTSLPALDRLLHG---GLPRGALTEVTGPSGCGKTQLCMMLSVLATLPKSLGGLDSG 133

  Fly   131 VLFIDTKREFSCKRIQDMLRAR-----EVDEEASERAMKGIRVVQAATGADINDLLKSFDHQLTA 190
            |::|||:..||.:|:.:|.::|     .|.|...|.|.: :.:.:..|..|:...|:..:..:.|
Zfish   134 VIYIDTESAFSAERLVEMAQSRFPEFFSVKERLLEMAAR-VHLFRELTCQDVLKRLERLEEDIIA 197

  Fly   191 ETHASMQTKLVLIDSLAACFAFYRGRRMRDV--------RKSVLTELACKIRKLALR-GVAFVIG 246
                 .:..||::||:|:..     |:..|.        |.:.|.:.|..::.|:.. .:..|:.
Zfish   198 -----CRAGLVILDSVASVV-----RKEFDTSLPGNLTHRSNFLGQEAAVLKYLSQEFCIPVVLT 252

  Fly   247 N-VSFFENNKDSCGDDGEQNGDDEE----VTRQQLEPMLGSYWSSVATLRLSVELPEEE------ 300
            | ::.....|..|....:.:...||    ||     ..||:.||.....||.|:..:.|      
Zfish   253 NQITTHVGEKLHCPQWNQTDASFEEDSGFVT-----AALGNTWSHSVNTRLIVQYEDSERRQIVI 312

  Fly   301 -----------DFTLQDDGLRFIYVISNTYGPDGEHCLLRITDAGV 335
                       .:|:|.:|:|    :.....|  |....|.||.|:
Zfish   313 AKSPVAPFAVLSYTIQKEGIR----LEENMNP--ESFSNRGTDPGL 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 70/298 (23%)
radB 80..335 CDD:236482 70/296 (24%)
rad51bNP_998577.1 Rad51 65..332 CDD:285604 64/286 (22%)
Rad51_DMC1_radA 79..333 CDD:238543 63/273 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.