DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and rhp55

DIOPT Version :8

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_593604.1 Gene:rhp55 / 2543685 PomBaseID:SPAC3C7.03c Length:350 Species:Schizosaccharomyces pombe

Alignment Length:207 Identity:51/207 - (24%)
Similarity:94/207 - (45%) Gaps:44/207 - (21%)


  Fly    74 PDFNYDTGIEELDKLLDSV--EQPFKPGRVWELCGQPGVGKTQLLYTLALNFVWKHSQAVLFIDT 136
            |.|.:::      ||||..  ....|.|.:.|:||.||:|||.|...:..|.:...|: |::::|
pombe    23 PGFGFNS------KLLDDAFGGSGLKRGYISEVCGAPGMGKTSLALQITANALLSGSR-VIWVET 80

  Fly   137 KREFSCKRIQDML-----RAREVDEEA-SERAMKGIRVVQAATGADINDLLKSFDHQLTAETHAS 195
            .:....:|::.:|     .:::.:|:. ::..:..:.||.|....:|...|::||.    |.|..
pombe    81 CQPIPMERLRQLLDNHVPSSQDEEEKCDTDELLNLLDVVYAPNLVNILAFLRNFDQ----EKHLK 141

  Fly   196 MQTKLVLIDSLA-----------ACFAFYRGRRMRDVRKSVLTELACKIRKLALRGVAFVIGNVS 249
             :..|::||:|:           ..:|:.|.|| ...:||.|::.:.|...|.|.          
pombe   142 -EIGLLIIDNLSMPIQLAYPTSPEDYAYLRLRR-NTSKKSSLSDSSQKENTLTLN---------- 194

  Fly   250 FFENNKDSCGDD 261
              :.|:.|..||
pombe   195 --KENEFSSKDD 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 49/201 (24%)
radB 80..335 CDD:236482 49/201 (24%)
rhp55NP_593604.1 RecA 1..295 CDD:223544 51/207 (25%)
P-loop_NTPase 29..327 CDD:304359 49/201 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4853
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.