DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and rfs-1

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001370362.1 Gene:rfs-1 / 24104262 WormBaseID:WBGene00004342 Length:245 Species:Caenorhabditis elegans


Alignment Length:287 Identity:59/287 - (20%)
Similarity:104/287 - (36%) Gaps:112/287 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FNYDTGIEELDKL-------------LDSVEQPFKPGRVWELCGQPGVGKTQLLYTLALNFV--- 124
            |.|:|..:.|.:|             ||.|.: ..||:.:|:.|..||||||:.|:.|..|:   
 Worm     8 FKYETAYDLLVRLGAERLFLRTCLSILDPVLE-LHPGKCYEIDGDLGVGKTQICYSFAAKFLQTK 71

  Fly   125 ------W------KHSQAVLFI---------DTKREFSCKRIQDMLRAREVDEEASERAMKGIRV 168
                  |      :....:|.|         |......|||::.:                    
 Worm    72 KTAKMGWIGATPLRTDHLLLHIEHFGNQTNEDILDRIVCKRVEKI-------------------- 116

  Fly   169 VQAATGADINDLLKSF-DHQLTAETHASMQTKLVLIDSLAACF--AFYRGRRMRDVRKSVLTELA 230
                  |::.|.|..| |         ::..:||:::::.|..  ..|.    :::.:|:.:::.
 Worm   117 ------AELQDSLTRFLD---------TINLQLVIVENIDAILHDTVYH----KEMGRSMQSDVV 162

  Fly   231 CKIRKLALRGVAFVIGNVSFFENNKDSCGDDGEQNGDDEEVT--RQQLEPMLGSYWSSVATLRLS 293
            .:||||....:..::.|                      .:|  |....|.||::|||....|..
 Worm   163 ERIRKLTKLEITVILTN----------------------HITHWRGYPAPALGAFWSSQINNRFF 205

  Fly   294 VE-LPEEEDFTL-------QDDGLRFI 312
            :| ..::.|..:       ||||:..|
 Worm   206 IEKRNDDSDIRIVSAMKGEQDDGMNRI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 57/283 (20%)
radB 80..335 CDD:236482 57/283 (20%)
rfs-1NP_001370362.1 P-loop_NTPase 40..214 CDD:422963 45/234 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4311
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105130
Panther 1 1.100 - - LDO PTHR46457
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.