DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad51D and Rad51c

DIOPT Version :9

Sequence 1:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_036012127.1 Gene:Rad51c / 114714 MGIID:2150020 Length:409 Species:Mus musculus


Alignment Length:164 Identity:46/164 - (28%)
Similarity:67/164 - (40%) Gaps:41/164 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 ELCGQPGVGKTQLLYTLALN------FVWKHSQAVLFIDTKREFSCKRIQDM---------LRAR 152
            |:||.||||||||...||::      |.....:|| ||||:..|...|:..:         |.|.
Mouse   228 EVCGVPGVGKTQLCMQLAVDVQIPECFGGVAGEAV-FIDTEGSFMVDRVVSLATACIQHLHLIAG 291

  Fly   153 EVDEEASERAMKGIRVVQAATGA------DINDLLKSF--------DHQLTAETHASMQTKLVLI 203
            ...||..::|:|...:....:..      |..:||...        ||.         :.:||:|
Mouse   292 THTEEEHQKALKDFTLENILSHIYYFRCHDYTELLAQVYLLPDFLSDHP---------KVQLVII 347

  Fly   204 DSLAACFAFYRGRRMRDVRKSVLTELACKIRKLA 237
            |.:|  |.|........:|..:|..||.::..||
Mouse   348 DGIA--FPFRHDLEDLSLRTRLLNGLAQQMISLA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 46/164 (28%)
radB 80..335 CDD:236482 46/164 (28%)
Rad51cXP_036012127.1 radA 127..409 CDD:235273 46/164 (28%)
Rad51C 224..>393 CDD:410900 46/164 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.