DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8008 and mdtG

DIOPT Version :9

Sequence 1:NP_001137623.1 Gene:CG8008 / 35935 FlyBaseID:FBgn0033387 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_415571.1 Gene:mdtG / 945627 ECOCYCID:EG11343 Length:408 Species:Escherichia coli


Alignment Length:455 Identity:76/455 - (16%)
Similarity:142/455 - (31%) Gaps:200/455 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 AFCGLFIGSWSDHYGRKPLLIVSMIGFSASFLMMAAICELSSYYVVNPWWYIMAAVPHSLLGGNC 169
            |....|.|..:|..|||.:|:.|.:|.....::|.        ...|.|.:::......||||  
E. coli    68 AIASPFWGGLADRKGRKLMLLRSALGMGIVMVLMG--------LAQNIWQFLILRALLGLLGG-- 122

  Fly   170 VFSVAAFCFISDITDCKSRPYRMIFMESLFFIGLTSGSLLSSFVYA-----AVGSAATIGISGCI 229
                    |:.:                       :.:|:::.|..     |:|:.:|.|:||.:
E. coli   123 --------FVPN-----------------------ANALIATQVPRNKSGWALGTLSTGGVSGAL 156

  Fly   230 --------------------VTFATLFIIFFVPESLHFHKEQETKNAITANVEKECIDSKVPITA 274
                                :|.:.|.:.|||  :|.                  ||        
E. coli   157 LGPMAGGLLADSYGLRPVFFITASVLILCFFV--TLF------------------CI-------- 193

  Fly   275 CDLQLDRVAIDCPPNFMNDEEPGKDKRMELPTPATPAMSFDDDLLAKYVERLPQKAEERKRQEAE 339
                                                                        |::.:
E. coli   194 ------------------------------------------------------------REKFQ 198

  Fly   340 EQAKKAGLFSMVHIRDMISTCFKRRDHHARAIIWLVTLAMFLSIFVFD----GVMTVMYLFVREK 400
            ..:||    .|:|:|:::::....:          :.|::|::..:..    .:..::.|:||| 
E. coli   199 PVSKK----EMLHMREVVTSLKNPK----------LVLSLFVTTLIIQVATGSIAPILTLYVRE- 248

  Fly   401 FHWTVRDYTFFETVSHLVPMIGALIGFLILRKV-FRLSVVTLALLAFFSEILNNLAKGFATMPWH 464
            ....|.:..|...:...||.:.||:....|.|: .|:....:.:.|....:|..:...:...|  
E. coli   249 LAGNVSNVAFISGMIASVPGVAALLSAPRLGKLGDRIGPEKILITALIFSVLLLIPMSYVQTP-- 311

  Fly   465 MYLSVTLGVFRSISG-------PMCRTIV----SNIVPPSDLGKIFSIKNVLQSFAPF--VAAPL 516
                :.||:.|.:.|       |..:|::    ||.:    .|:|||..   |||...  |..||
E. coli   312 ----LQLGILRFLLGAADGALLPAVQTLLVYNSSNQI----AGRIFSYN---QSFRDIGNVTGPL 365

  Fly   517  516
            E. coli   366  365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8008NP_001137623.1 MFS 101..547 CDD:119392 76/455 (17%)
MFS_1 101..>261 CDD:284993 32/180 (18%)
MFS_1 375..>558 CDD:284993 36/160 (23%)
mdtGNP_415571.1 PRK09874 1..408 CDD:182127 76/455 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.