DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8008 and CG17637

DIOPT Version :9

Sequence 1:NP_001137623.1 Gene:CG8008 / 35935 FlyBaseID:FBgn0033387 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_649237.1 Gene:CG17637 / 40275 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster


Alignment Length:494 Identity:108/494 - (21%)
Similarity:201/494 - (40%) Gaps:85/494 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PYVANL---FLARTLL-ESIVPAFCGLF-------IGSWSDHYGRKPLLIVSMIGFSA--SFLMM 138
            |::..|   |..|.|| :.:|....|:.       :|:.||.:|||.::::::....|  .|:|:
  Fly    45 PFIEKLSGSFGNRVLLVDGLVYGVRGILGFVTTPVMGAISDFHGRKVVMLLAVATTYAPIPFMML 109

  Fly   139 AAICELSSYYVVNPWWYIMAAVPHSLLGGNCVFSVAAFCFISDITDCKSRPYRMIFMESLFFIGL 203
            .:            ||:.......|:.|.....|:|   :::|.|..::|.....|:.:.|..|:
  Fly   110 KS------------WWFFAILTVSSICGSTYSSSLA---YVADTTTVENRSKGYGFVAASFGAGI 159

  Fly   204 TSGSLLSSFVYAAVGSAATIGISGCIVTFATLFIIFFVPESLHFHKEQETKNAITANVEKECIDS 268
            .....|.:::..:.|||:.|.|:........|||||.|||||..   :|.|..:..|.:.:..|:
  Fly   160 AFSPSLGNYLMKSYGSASVILIATITGMINILFIIFAVPESLVL---KEKKVILNENNDNKVEDT 221

  Fly   269 KVPITACDLQLDRVAIDCPPNFMNDEEPGKDK-RMELPTPATPAMSFDDDLLAKYVERLPQKAEE 332
            ||.             |..|....:...|:.| .:|:..|.:..:..:.:|..::      ..||
  Fly   222 KVD-------------DISPKEKKENLNGEGKVNVEVNKPTSQNIVTNKELDQQF------SKEE 267

  Fly   333 RKRQEAEEQAKKAGLFSMVHIRDMISTCFKRRDHHARAIIWLVTLAMFLSIFVFDGVMTVMYLFV 397
            ..:.:..|:.|...  ..::..|:.....|.|......:|:|:|   ||||:.|.||.:...:::
  Fly   268 NLQNDLTEKEKIDN--GSLNSSDLWEVLRKSRKDKNLLVIYLIT---FLSIWPFAGVDSTAPVYL 327

  Fly   398 REKFHWTVRDYTFFETVSHLVPMIGA-------LIGFLILRKVFRLSVVTLALLAFFSEILNNLA 455
            :....:.      :|.||.::.::..       |:|: |:..|.....:.|.||..|   |..|.
  Fly   328 KTNMGFE------YEEVSMMLGLLSVLAITSNILLGY-IMNIVGAKWSIRLGLLLLF---LQMLF 382

  Fly   456 KGFATMPWHMYLSVTLGVFRSISGPMCRTIVSNIVPPSDLGKIFSIKNVLQSFAPFVAAPLYTLI 520
            .||.|..|..:||..|....:|.......:.|....|.:.|.:..|.:.::..:..|....:.|:
  Fly   383 FGFGTHHWMYWLSSILAALATIIPAANNAVASIYASPDNRGAVLGIISGIECLSEGVGPAFFGLL 447

  Fly   521 Y------------KRSLTTYPGLFNFVSSFLYLLSFVFI 547
            :            ..|..:.|.:.:.:|.|:.::...||
  Fly   448 FFIFQDDSETDLKVNSPISMPFVISAISVFVAIVLSSFI 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8008NP_001137623.1 MFS 101..547 CDD:119392 100/474 (21%)
MFS_1 101..>261 CDD:284993 41/168 (24%)
MFS_1 375..>558 CDD:284993 41/192 (21%)
CG17637NP_649237.1 MFS 25..487 CDD:119392 108/494 (22%)
MFS_1 30..441 CDD:284993 101/447 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.